Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) |
Family a.4.13.1: Sigma3 domain [88660] (3 proteins) |
Protein Sigma70 [88661] (2 species) |
Species Thermus thermophilus [TaxId:274] [88662] (11 PDB entries) Uniprot Q9WX78 |
Domain d6cuuf2: 6cuu F:258-318 [355107] Other proteins in same PDB: d6cuua1, d6cuua2, d6cuub1, d6cuub2, d6cuuc_, d6cuud_, d6cuue_, d6cuuf1, d6cuuf3 automated match to d1smyf1 protein/DNA complex; protein/RNA complex; complexed with kng, mg, zn |
PDB Entry: 6cuu (more details), 2.99 Å
SCOPe Domain Sequences for d6cuuf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cuuf2 a.4.13.1 (F:258-318) Sigma70 {Thermus thermophilus [TaxId: 274]} iripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqepvsl e
Timeline for d6cuuf2: