Lineage for d6cuuf1 (6cuu F:78-257)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735969Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily)
    multihelical; consists of a conserved 4-helical core and a variable insert subdomain
  4. 2735970Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (2 families) (S)
  5. 2735971Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (6 proteins)
  6. 2735987Protein Sigma70 [88948] (2 species)
  7. 2735992Species Thermus thermophilus [TaxId:274] [88949] (11 PDB entries)
    Uniprot Q9WX78
  8. 2736010Domain d6cuuf1: 6cuu F:78-257 [355106]
    Other proteins in same PDB: d6cuua1, d6cuua2, d6cuub1, d6cuub2, d6cuuc_, d6cuud_, d6cuue_, d6cuuf2, d6cuuf3
    automated match to d1smyf3
    protein/DNA complex; protein/RNA complex; complexed with kng, mg, zn

    has additional subdomain(s) that are not in the common domain

Details for d6cuuf1

PDB Entry: 6cuu (more details), 2.99 Å

PDB Description: thermus thermophiles rna polymerase in complex with promoter dna and antibiotic kanglemycin a
PDB Compounds: (F:) RNA polymerase sigma factor SigA

SCOPe Domain Sequences for d6cuuf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cuuf1 a.177.1.1 (F:78-257) Sigma70 {Thermus thermophilus [TaxId: 274]}
sdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvrakilg
sarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlrlvvs
iakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiadqart

SCOPe Domain Coordinates for d6cuuf1:

Click to download the PDB-style file with coordinates for d6cuuf1.
(The format of our PDB-style files is described here.)

Timeline for d6cuuf1: