Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily) unusual fold; contains a left-handed beta-alpha-beta unit |
Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) automatically mapped to Pfam PF01000 |
Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (3 proteins) |
Protein RNA polymerase alpha subunit [56555] (3 species) |
Species Thermus thermophilus [TaxId:274] [75595] (16 PDB entries) Uniprot Q9Z9H6; part of multichain biological unit |
Domain d6cuub2: 6cuu B:50-172 [355105] Other proteins in same PDB: d6cuua1, d6cuub1, d6cuuc_, d6cuud_, d6cuue_, d6cuuf1, d6cuuf2, d6cuuf3 automated match to d1smya2 protein/DNA complex; protein/RNA complex; complexed with kng, mg, zn |
PDB Entry: 6cuu (more details), 2.99 Å
SCOPe Domain Sequences for d6cuub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cuub2 d.181.1.1 (B:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]} gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda vfs
Timeline for d6cuub2: