Lineage for d5wh5a_ (5wh5 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736615Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2736616Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. 2736712Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2736776Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)
  7. 2736777Species Human (Homo sapiens) [TaxId:9606] [89152] (89 PDB entries)
    Uniprot Q08499 388-713
  8. 2736876Domain d5wh5a_: 5wh5 A: [355043]
    automated match to d3g4id_
    complexed with mg, r91, zn

Details for d5wh5a_

PDB Entry: 5wh5 (more details), 1.8 Å

PDB Description: crystal structure of the pde4d2 catalytic domain in complex with inhibitor (r)-zl-n-91
PDB Compounds: (A:) cAMP-specific 3',5'-cyclic phosphodiesterase 4D

SCOPe Domain Sequences for d5wh5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wh5a_ a.211.1.2 (A:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp
gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
lqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
dlvhpdaqdildtlednrewyqstip

SCOPe Domain Coordinates for d5wh5a_:

Click to download the PDB-style file with coordinates for d5wh5a_.
(The format of our PDB-style files is described here.)

Timeline for d5wh5a_: