Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Zebrafish (Danio rerio) [TaxId:7955] [355038] (1 PDB entry) |
Domain d5xz2a_: 5xz2 A: [355039] automated match to d2bwja_ complexed with ap5, so4 |
PDB Entry: 5xz2 (more details), 1.75 Å
SCOPe Domain Sequences for d5xz2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xz2a_ c.37.1.0 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]} adkiknakivfvvggpgsgkgtqcekivakygythlssgdllraevasgsergkqlqaim qkgelvpldtvldmikdamiakadvskgylidgyprevkqgeefekkigapalllyidak getmvkrlmkrgetsgraddneetikkrldlyykatepviafyeqrgivrkinselpvde vfaivekaidel
Timeline for d5xz2a_: