SCOPe 2.08: Domain d5xz3a1: 5xz3 A:4-173

Lineage for d5xz3a1 (5xz3 A:4-173)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families)

5. Family d.118.1.0: automated matches [191348] (1 protein)
   not a true family

6. Protein automated matches [190280] (10 species)
   not a true protein

7. Species Honeybee (Apis mellifera) [TaxId:7460] [355009] (1 PDB entry)

8. Domain d5xz3a1: 5xz3 A:4-173 [355012]
   Other proteins in same PDB: d5xz3a2
   automated match to d1ycka1
   complexed with so4

Details for d5xz3a1

PDB Entry: 5xz3, 1.86 Å

PDB Description: the x-ray structure of apis mellifera pgrp-sa

PDB Compounds: (A:) Peptidoglycan-recognition protein

SCOPe Domain Sequences for d5xz3a1:

Sequence; same for both SEQRES and ATOM records:

>d5xz3a1 d.118.1.0 (A:4-173) automated matches {Honeybee (Apis mellifera) [TaxId: 7460]}
dencseiikrnewtnvqakninyliipipyviihhtvslecnskdtcisnienirsyhmd
tlnwhdigysfliggdgniyegcgwnhegahtygynkksisiafignfqnksasnkmlna
ahklilcgkskgilredvrviggkqviatlspgfelykqiqnwpewvstp

Timeline for d5xz3a1:

• d5xz3a1 first appeared in SCOPe 2.07