Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187090] (152 PDB entries) |
Domain d6byhh1: 6byh H:0-74 [354957] Other proteins in same PDB: d6byha1, d6byha2, d6byha3, d6byhb1, d6byhb2, d6byhb3, d6byhc2, d6byhd2, d6byhg1, d6byhg2, d6byhg3, d6byhh2 automated match to d5v6ab_ |
PDB Entry: 6byh (more details), 2.61 Å
SCOPe Domain Sequences for d6byhh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6byhh1 d.15.1.0 (H:0-74) automated matches {Human (Homo sapiens) [TaxId: 9606]} gmqifvktrhsykhglienstitlevepsdtienvkakiqdkegippdqqvlifsrkrle dgrtlsdyniqkestlrlvlvfg
Timeline for d6byhh1: