SCOPe 2.07: Domain d6byhh1: 6byh H:0-74

Lineage for d6byhh1 (6byh H:0-74)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187090] (152 PDB entries)

8. Domain d6byhh1: 6byh H:0-74 [354957]
   Other proteins in same PDB: d6byha1, d6byha2, d6byha3, d6byhb1, d6byhb2, d6byhb3, d6byhc2, d6byhd2, d6byhg1, d6byhg2, d6byhg3, d6byhh2
   automated match to d5v6ab_

Details for d6byhh1

PDB Entry: 6byh, 2.61 Å

PDB Description: ubiquitin variant (ubv.fl11.1) bound to a human skp1-fbl11 fragment complex.

PDB Compounds: (H:) Polyubiquitin-B

SCOPe Domain Sequences for d6byhh1:

Sequence; same for both SEQRES and ATOM records:

>d6byhh1 d.15.1.0 (H:0-74) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gmqifvktrhsykhglienstitlevepsdtienvkakiqdkegippdqqvlifsrkrle
dgrtlsdyniqkestlrlvlvfg

Timeline for d6byhh1:

• d6byhh1 is new in SCOPe 2.07-stable
  
• d6byhh1 appears in the current release, SCOPe 2.08