SCOPe 2.07: Domain d6byhb1: 6byh B:1-71

Lineage for d6byhb1 (6byh B:1-71)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.0: automated matches [191460] (1 protein)
   not a true family

6. Protein automated matches [190710] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187857] (53 PDB entries)

8. Domain d6byhb1: 6byh B:1-71 [354909]
   Other proteins in same PDB: d6byha2, d6byha3, d6byhb2, d6byhb3, d6byhc1, d6byhc2, d6byhd1, d6byhd2, d6byhg2, d6byhg3, d6byhh1, d6byhh2
   automated match to d5k35b1

Details for d6byhb1

PDB Entry: 6byh, 2.61 Å

PDB Description: ubiquitin variant (ubv.fl11.1) bound to a human skp1-fbl11 fragment complex.

PDB Compounds: (B:) S-phase kinase-associated protein 1

SCOPe Domain Sequences for d6byhb1:

Sequence, based on SEQRES records:

>d6byhb1 d.42.1.0 (B:1-71) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpsiklqssdgeifevdveiakqsvtiktmledlgmddegdddpvplpnvnaailkkviq
wcthhkddppp

Sequence, based on observed residues (ATOM records):

>d6byhb1 d.42.1.0 (B:1-71) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpsiklqssdgeifevdveiakqsvtiktmledldddpvplpnvnaailkkviqwcthhk
ddppp

Timeline for d6byhb1:

• d6byhb1 is new in SCOPe 2.07-stable
  
• d6byhb1 appears in the current release, SCOPe 2.08