Lineage for d6d21a3 (6d21 A:237-331)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2394380Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2394381Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2394983Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2394984Protein automated matches [190052] (7 species)
    not a true protein
  7. 3054798Species Danio rerio [TaxId:7955] [354860] (2 PDB entries)
  8. 3054845Domain d6d21a3: 6d21 A:237-331 [354907]
    Other proteins in same PDB: d6d21a1, d6d21a2
    automated match to d2he7a3

Details for d6d21a3

PDB Entry: 6d21 (more details), 2 Å

PDB Description: crystal structure of the ferm domain of zebrafish farp2
PDB Compounds: (A:) FERM, RhoGEF and pleckstrin domain protein 2

SCOPe Domain Sequences for d6d21a3:

Sequence, based on SEQRES records: (download)

>d6d21a3 b.55.1.0 (A:237-331) automated matches {Danio rerio [TaxId: 7955]}
gvrfhpaadregtkinlavahmglqvfqghtkintfnwskirklsfkrkrfliklhpevh
gphqdtleflmgsrdqckifwkncvehhsffrlld

Sequence, based on observed residues (ATOM records): (download)

>d6d21a3 b.55.1.0 (A:237-331) automated matches {Danio rerio [TaxId: 7955]}
gvrfhpaadregtkinlavahmglqvfqghtkintfnwskirklsfkrkrfliklhpeph
qdtleflmgsrdqckifwkncvehhsffrlld

SCOPe Domain Coordinates for d6d21a3:

Click to download the PDB-style file with coordinates for d6d21a3.
(The format of our PDB-style files is described here.)

Timeline for d6d21a3:

  • d6d21a3 appears in periodic updates to SCOPe 2.07 starting on 2018-07-19