SCOPe 2.07: Domain d6dbgc_: 6dbg C:

Lineage for d6dbgc_ (6dbg C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Camel (Camelus dromedarius) [TaxId:9838] [276268] (8 PDB entries)

8. Domain d6dbgc_: 6dbg C: [354884]
   Other proteins in same PDB: d6dbga1, d6dbga2, d6dbgb1, d6dbgb2
   automated match to d4nbzb_

Details for d6dbgc_

PDB Entry: 6dbg, 1.51 Å

PDB Description: crystal structure of vhh r303 in complex with inlb-lrr-ir

PDB Compounds: (C:) vhh r303

SCOPe Domain Sequences for d6dbgc_:

Sequence, based on SEQRES records:

>d6dbgc_ b.1.1.0 (C:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
vkleesgggsvqaggslrlscaasghtystycmgwfrqvpgkeregvarinvggsstwya
dsvrdrftisqdnakntvylqmnslkledtaiyyctlhrfcntwslgtlnvwgqgtqvtv
ss

Sequence, based on observed residues (ATOM records):

>d6dbgc_ b.1.1.0 (C:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
vkleesgggsvqaggslrlscaasghtystycmgwfrqeregvarinvggsstwyadsvr
drftisqdnakntvylqmnslkledtaiyyctlhrfcntwslgtlnvwgqgtqvtvss

Timeline for d6dbgc_:

• d6dbgc_ is new in SCOPe 2.07-stable
  
• d6dbgc_ appears in the current release, SCOPe 2.08