Lineage for d6dbaa_ (6dba A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2355238Species Camel (Camelus dromedarius) [TaxId:9838] [276268] (4 PDB entries)
  8. 3054820Domain d6dbaa_: 6dba A: [354882]
    automated match to d4nbzb_

Details for d6dbaa_

PDB Entry: 6dba (more details), 1.3 Å

PDB Description: crystal structure of vhh r303
PDB Compounds: (A:) nanobody VHH R303

SCOPe Domain Sequences for d6dbaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dbaa_ b.1.1.0 (A:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
qvkleesgggsvqaggslrlscaasghtystycmgwfrqvpgkeregvarinvggsstwy
adsvrdrftisqdnakntvylqmnslkledtaiyyctlhrfcntwslgtlnvwgqgtqvt
vss

SCOPe Domain Coordinates for d6dbaa_:

Click to download the PDB-style file with coordinates for d6dbaa_.
(The format of our PDB-style files is described here.)

Timeline for d6dbaa_:

  • d6dbaa_ appears in periodic updates to SCOPe 2.07 starting on 2018-07-19

View in 3D
Domains from other chains:
(mouse over for more information)
d6dbab_