Lineage for d6dbea_ (6dbe A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759403Species Llama (Lama glama) [TaxId:9844] [189241] (37 PDB entries)
  8. 2759409Domain d6dbea_: 6dbe A: [354873]
    automated match to d4nbzb_
    complexed with epe

Details for d6dbea_

PDB Entry: 6dbe (more details), 1.65 Å

PDB Description: crystal structure of vhh r330
PDB Compounds: (A:) nanobody VHH R303

SCOPe Domain Sequences for d6dbea_:

Sequence, based on SEQRES records: (download)

>d6dbea_ b.1.1.0 (A:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vkleesggglvqaggslrlscaasgstfsiytmgwfrqapgkerefvadiswnggstyya
dsvkgrftiyrdnykntvylqmnslkpedtavyycnaddlmidrdywgqgtqvtvs

Sequence, based on observed residues (ATOM records): (download)

>d6dbea_ b.1.1.0 (A:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vkleesggglvqaggslrlscaasgtfsiytmgwfrqapgkerefvadiswnggstyyad
svkgrftiyrdnykntvylqmnslkpedtavyycnaddlmidrdywgqgtqvtvs

SCOPe Domain Coordinates for d6dbea_:

Click to download the PDB-style file with coordinates for d6dbea_.
(The format of our PDB-style files is described here.)

Timeline for d6dbea_: