Lineage for d6dbgd_ (6dbg D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754040Species Camel (Camelus dromedarius) [TaxId:9838] [276268] (8 PDB entries)
  8. 2754048Domain d6dbgd_: 6dbg D: [354869]
    Other proteins in same PDB: d6dbga1, d6dbga2, d6dbgb1, d6dbgb2
    automated match to d4nbzb_

Details for d6dbgd_

PDB Entry: 6dbg (more details), 1.51 Å

PDB Description: crystal structure of vhh r303 in complex with inlb-lrr-ir
PDB Compounds: (D:) vhh r303

SCOPe Domain Sequences for d6dbgd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dbgd_ b.1.1.0 (D:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
vkleesgggsvqaggslrlscaasghtystycmgwfrqvpgkeregvarinvggsstwya
dsvrdrftisqdnakntvylqmnslkledtaiyyctlhrfcntwslgtlnvwgqgtqvtv
ss

SCOPe Domain Coordinates for d6dbgd_:

Click to download the PDB-style file with coordinates for d6dbgd_.
(The format of our PDB-style files is described here.)

Timeline for d6dbgd_: