Lineage for d6d2ka3 (6d2k A:230-322)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2394380Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2394381Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2394983Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2394984Protein automated matches [190052] (7 species)
    not a true protein
  7. 2395109Species Mouse (Mus musculus) [TaxId:10090] [232271] (6 PDB entries)
  8. 3054797Domain d6d2ka3: 6d2k A:230-322 [354859]
    Other proteins in same PDB: d6d2ka1, d6d2ka2, d6d2ka4
    automated match to d2he7a3

Details for d6d2ka3

PDB Entry: 6d2k (more details), 1.55 Å

PDB Description: crystal structure of the ferm domain of mouse farp2
PDB Compounds: (A:) FERM, ARHGEF and pleckstrin domain-containing protein 2

SCOPe Domain Sequences for d6d2ka3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d2ka3 b.55.1.0 (A:230-322) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
girfhmasdregtkinlavshmgvlvfqgttkintfnwskvrklsfkrkrfliklhpevh
gpyqdtlefllgsrdecknfwkicveyhtffrl

SCOPe Domain Coordinates for d6d2ka3:

Click to download the PDB-style file with coordinates for d6d2ka3.
(The format of our PDB-style files is described here.)

Timeline for d6d2ka3:

  • d6d2ka3 appears in periodic updates to SCOPe 2.07 starting on 2018-07-19