Lineage for d6cdsb3 (6cds B:215-339)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803713Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2803714Protein automated matches [190052] (8 species)
    not a true protein
  7. 2803789Species Human (Homo sapiens) [TaxId:9606] [186914] (120 PDB entries)
  8. 2803907Domain d6cdsb3: 6cds B:215-339 [354851]
    Other proteins in same PDB: d6cdsa1, d6cdsa2, d6cdsb1, d6cdsb2
    automated match to d1isna2
    complexed with gol, peg, pio, po4

Details for d6cdsb3

PDB Entry: 6cds (more details), 2.62 Å

PDB Description: human neurofibromin 2/merlin/schwannomin residues 1-339 in complex with pip2
PDB Compounds: (B:) merlin

SCOPe Domain Sequences for d6cdsb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cdsb3 b.55.1.0 (B:215-339) automated matches {Human (Homo sapiens) [TaxId: 9606]}
emygvnyfairnkkgtelllgvdalglhiydpenrltpkisfpwneirnisysdkeftik
pldkkidvfkfnssklrvnklilqlcienhdlfmrrrkadslevqqmkaqareekarkqm
erqrl

SCOPe Domain Coordinates for d6cdsb3:

Click to download the PDB-style file with coordinates for d6cdsb3.
(The format of our PDB-style files is described here.)

Timeline for d6cdsb3: