Lineage for d6cdsb2 (6cds B:104-214)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309710Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2309753Superfamily a.11.2: Second domain of FERM [47031] (2 families) (S)
    automatically mapped to Pfam PF00373
  5. 2309829Family a.11.2.0: automated matches [254193] (1 protein)
    not a true family
  6. 2309830Protein automated matches [254423] (4 species)
    not a true protein
  7. 2309834Species Human (Homo sapiens) [TaxId:9606] [255207] (9 PDB entries)
  8. 3054787Domain d6cdsb2: 6cds B:104-214 [354848]
    Other proteins in same PDB: d6cdsa1, d6cdsa3, d6cdsb1, d6cdsb3
    automated match to d1isna1
    complexed with gol, peg, pio, po4

Details for d6cdsb2

PDB Entry: 6cds (more details), 2.62 Å

PDB Description: human neurofibromin 2/merlin/schwannomin residues 1-339 in complex with pip2
PDB Compounds: (B:) merlin

SCOPe Domain Sequences for d6cdsb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cdsb2 a.11.2.0 (B:104-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
naeeelvqeitqhlfflqvkkqildekiycppeasvllasyavqakygdydpsvhkrgfl
aqeellpkrvinlyqmtpemweeritawyaehrgrardeaemeylkiaqdl

SCOPe Domain Coordinates for d6cdsb2:

Click to download the PDB-style file with coordinates for d6cdsb2.
(The format of our PDB-style files is described here.)

Timeline for d6cdsb2:

  • d6cdsb2 appears in periodic updates to SCOPe 2.07 starting on 2018-07-19