Lineage for d6cdsa1 (6cds A:15-103)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2502613Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2502614Protein automated matches [190233] (26 species)
    not a true protein
  7. 2502649Species Human (Homo sapiens) [TaxId:9606] [187090] (82 PDB entries)
  8. 3054784Domain d6cdsa1: 6cds A:15-103 [354846]
    Other proteins in same PDB: d6cdsa2, d6cdsa3, d6cdsb2, d6cdsb3
    automated match to d1isna3
    complexed with gol, peg, pio, po4

Details for d6cdsa1

PDB Entry: 6cds (more details), 2.62 Å

PDB Description: human neurofibromin 2/merlin/schwannomin residues 1-339 in complex with pip2
PDB Compounds: (A:) merlin

SCOPe Domain Sequences for d6cdsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cdsa1 d.15.1.0 (A:15-103) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krkqpktftvrivtmdaemefncemkwkgkdlfdlvcrtlglretwffglqytikdtvaw
lkmdkkvldhdvskeepvtfhflakfype

SCOPe Domain Coordinates for d6cdsa1:

Click to download the PDB-style file with coordinates for d6cdsa1.
(The format of our PDB-style files is described here.)

Timeline for d6cdsa1:

  • d6cdsa1 appears in periodic updates to SCOPe 2.07 starting on 2018-07-19