Lineage for d6byhd1 (6byh D:0-75)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2540226Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2540227Protein automated matches [190233] (31 species)
    not a true protein
  7. 2540283Species Human (Homo sapiens) [TaxId:9606] [187090] (152 PDB entries)
  8. 2540441Domain d6byhd1: 6byh D:0-75 [354843]
    Other proteins in same PDB: d6byha1, d6byha2, d6byha3, d6byhb1, d6byhb2, d6byhb3, d6byhc2, d6byhd2, d6byhg1, d6byhg2, d6byhg3, d6byhh2
    automated match to d5v6ab_

Details for d6byhd1

PDB Entry: 6byh (more details), 2.61 Å

PDB Description: ubiquitin variant (ubv.fl11.1) bound to a human skp1-fbl11 fragment complex.
PDB Compounds: (D:) Polyubiquitin-B

SCOPe Domain Sequences for d6byhd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6byhd1 d.15.1.0 (D:0-75) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gmqifvktrhsykhglienstitlevepsdtienvkakiqdkegippdqqvlifsrkrle
dgrtlsdyniqkestlrlvlvfgr

SCOPe Domain Coordinates for d6byhd1:

Click to download the PDB-style file with coordinates for d6byhd1.
(The format of our PDB-style files is described here.)

Timeline for d6byhd1: