Lineage for d6bvad2 (6bva D:79-161)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735465Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
    multihelical; interlocked heterodimer with F-box proteins
  4. 2735466Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) (S)
    automatically mapped to Pfam PF01466
  5. 2735467Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins)
  6. 2735494Protein automated matches [226933] (1 species)
    not a true protein
  7. 2735495Species Human (Homo sapiens) [TaxId:9606] [225235] (12 PDB entries)
  8. 2735507Domain d6bvad2: 6bva D:79-161 [354834]
    Other proteins in same PDB: d6bvaa1, d6bvaa2, d6bvab_, d6bvac1, d6bvad1, d6bvad3
    automated match to d5k35b2

Details for d6bvad2

PDB Entry: 6bva (more details), 2.66 Å

PDB Description: ubiquitin variant (ubv.fl10.1) bound to a human skp1-fbl10 fragment complex.
PDB Compounds: (D:) S-phase kinase-associated protein 1

SCOPe Domain Sequences for d6bvad2:

Sequence, based on SEQRES records: (download)

>d6bvad2 a.157.1.1 (D:79-161) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ekrtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirkt
fnikndfteeeeaqvrkenqwce

Sequence, based on observed residues (ATOM records): (download)

>d6bvad2 a.157.1.1 (D:79-161) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ekrtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirkt
fnikndeeeeaqvrkenqwce

SCOPe Domain Coordinates for d6bvad2:

Click to download the PDB-style file with coordinates for d6bvad2.
(The format of our PDB-style files is described here.)

Timeline for d6bvad2: