Lineage for d6byha1 (6byh A:1-70)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2513276Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2513277Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2513558Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 2513559Protein automated matches [190710] (4 species)
    not a true protein
  7. 2513560Species Human (Homo sapiens) [TaxId:9606] [187857] (46 PDB entries)
  8. 3054767Domain d6byha1: 6byh A:1-70 [354829]
    Other proteins in same PDB: d6byha2, d6byha3, d6byhb2, d6byhb3, d6byhc1, d6byhc2, d6byhd1, d6byhd2, d6byhg2, d6byhg3, d6byhh1, d6byhh2
    automated match to d5k35b1

Details for d6byha1

PDB Entry: 6byh (more details), 2.61 Å

PDB Description: ubiquitin variant (ubv.fl11.1) bound to a human skp1-fbl11 fragment complex.
PDB Compounds: (A:) S-phase kinase-associated protein 1

SCOPe Domain Sequences for d6byha1:

Sequence, based on SEQRES records: (download)

>d6byha1 d.42.1.0 (A:1-70) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpsiklqssdgeifevdveiakqsvtiktmledlgmddegdddpvplpnvnaailkkviq
wcthhkddpp

Sequence, based on observed residues (ATOM records): (download)

>d6byha1 d.42.1.0 (A:1-70) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpsiklqssdgeifevdveiakqsvtiktmleddddpvplpnvnaailkkviqwcthhkd
dpp

SCOPe Domain Coordinates for d6byha1:

Click to download the PDB-style file with coordinates for d6byha1.
(The format of our PDB-style files is described here.)

Timeline for d6byha1:

  • d6byha1 appears in periodic updates to SCOPe 2.07 starting on 2018-07-19