![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
![]() | Superfamily d.42.1: POZ domain [54695] (3 families) ![]() |
![]() | Family d.42.1.0: automated matches [191460] (1 protein) not a true family |
![]() | Protein automated matches [190710] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187857] (53 PDB entries) |
![]() | Domain d6byhg1: 6byh G:1-69 [354826] Other proteins in same PDB: d6byha2, d6byha3, d6byhb2, d6byhb3, d6byhc1, d6byhc2, d6byhd1, d6byhd2, d6byhg2, d6byhg3, d6byhh1, d6byhh2 automated match to d5k35b1 |
PDB Entry: 6byh (more details), 2.61 Å
SCOPe Domain Sequences for d6byhg1:
Sequence, based on SEQRES records: (download)
>d6byhg1 d.42.1.0 (G:1-69) automated matches {Human (Homo sapiens) [TaxId: 9606]} mpsiklqssdgeifevdveiakqsvtiktmledlgmddegdddpvplpnvnaailkkviq wcthhkddp
>d6byhg1 d.42.1.0 (G:1-69) automated matches {Human (Homo sapiens) [TaxId: 9606]} mpsiklqssdgeifevdveiakqsvtiktmledddpvplpnvnaailkkviqwcthhkdd p
Timeline for d6byhg1: