Lineage for d5y8ma2 (5y8m A:160-290)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721533Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2721534Protein automated matches [226851] (46 species)
    not a true protein
  7. 2721849Species Mycobacterium tuberculosis [TaxId:83332] [354674] (11 PDB entries)
  8. 2721860Domain d5y8ma2: 5y8m A:160-290 [354817]
    Other proteins in same PDB: d5y8ma1, d5y8mb1
    automated match to d1yb4a2
    complexed with 9on, akr, gol, hiu, nad

Details for d5y8ma2

PDB Entry: 5y8m (more details), 2.04 Å

PDB Description: mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + nad + (r)-3-hydroxyisobutyrate (r-hiba)
PDB Compounds: (A:) Probable 3-hydroxyisobutyrate dehydrogenase

SCOPe Domain Sequences for d5y8ma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y8ma2 a.100.1.0 (A:160-290) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
aagagqaakvcnnmvlavqqiaiaeafvlaeklglsaqslfdvitgatgncwavhtncpv
pgpvptspanndfkpgfstalmnkdlglamdavaatgataplgshaadiyakfaadhadl
dfsavihtlra

SCOPe Domain Coordinates for d5y8ma2:

Click to download the PDB-style file with coordinates for d5y8ma2.
(The format of our PDB-style files is described here.)

Timeline for d5y8ma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5y8ma1