Lineage for d5xyla1 (5xyl A:1-75)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2513276Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2513277Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2513558Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 2513559Protein automated matches [190710] (4 species)
    not a true protein
  7. 2513560Species Human (Homo sapiens) [TaxId:9606] [187857] (47 PDB entries)
  8. 3054752Domain d5xyla1: 5xyl A:1-75 [354814]
    Other proteins in same PDB: d5xyla2
    automated match to d5k35b1

Details for d5xyla1

PDB Entry: 5xyl (more details)

PDB Description: solution structure of skp1 from homo sapiens
PDB Compounds: (A:) S-phase kinase-associated protein 1

SCOPe Domain Sequences for d5xyla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xyla1 d.42.1.0 (A:1-75) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpsiklqssdgeifevdveiakqsvtiktmledlgmddegdddpvplpnvnaailkkviq
wcthhkddppppedd

SCOPe Domain Coordinates for d5xyla1:

Click to download the PDB-style file with coordinates for d5xyla1.
(The format of our PDB-style files is described here.)

Timeline for d5xyla1:

  • d5xyla1 appears in periodic updates to SCOPe 2.07 starting on 2018-07-12

View in 3D
Domains from same chain:
(mouse over for more information)
d5xyla2