Lineage for d5xz5b2 (5xz5 B:275-398)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917454Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [354746] (2 PDB entries)
  8. 2917462Domain d5xz5b2: 5xz5 B:275-398 [354810]
    automated match to d5byva2

Details for d5xz5b2

PDB Entry: 5xz5 (more details), 2.2 Å

PDB Description: purification,crystallization and structural analysis of cytoplastic acetoacetyl-coa thiolase from saccharomyces cerevisiae
PDB Compounds: (B:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d5xz5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xz5b2 c.95.1.0 (B:275-398) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
kplaiikgwgeaahqpadftwapslavpkalkhagiedinsvdyfefneafsvvglvntk
ilkldpskvnvyggavalghplgcsgarvvvtllsilqqeggkigvaaicnggggassiv
ieki

SCOPe Domain Coordinates for d5xz5b2:

Click to download the PDB-style file with coordinates for d5xz5b2.
(The format of our PDB-style files is described here.)

Timeline for d5xz5b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5xz5b1