SCOPe 2.08: Domain d5xz5a2: 5xz5 A:275-398

Lineage for d5xz5a2 (5xz5 A:275-398)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [354746] (2 PDB entries)

8. Domain d5xz5a2: 5xz5 A:275-398 [354801]
   automated match to d5byva2

Details for d5xz5a2

PDB Entry: 5xz5, 2.2 Å

PDB Description: purification,crystallization and structural analysis of cytoplastic acetoacetyl-coa thiolase from saccharomyces cerevisiae

PDB Compounds: (A:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d5xz5a2:

Sequence; same for both SEQRES and ATOM records:

>d5xz5a2 c.95.1.0 (A:275-398) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
kplaiikgwgeaahqpadftwapslavpkalkhagiedinsvdyfefneafsvvglvntk
ilkldpskvnvyggavalghplgcsgarvvvtllsilqqeggkigvaaicnggggassiv
ieki

Timeline for d5xz5a2:

• d5xz5a2 first appeared in SCOPe 2.07