Lineage for d6drvd2 (6drv D:221-334)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2359630Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2360089Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2360090Protein automated matches [254633] (12 species)
    not a true protein
  7. 2360314Species Escherichia coli [TaxId:83333] [272134] (10 PDB entries)
  8. 3054730Domain d6drvd2: 6drv D:221-334 [354792]
    Other proteins in same PDB: d6drvd1, d6drvd3, d6drvd5
    automated match to d1jz8a1

Details for d6drvd2

PDB Entry: 6drv (more details), 2.2 Å

PDB Description: beta-galactosidase
PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d6drvd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6drvd2 b.1.4.0 (D:221-334) automated matches {Escherichia coli [TaxId: 83333]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOPe Domain Coordinates for d6drvd2:

Click to download the PDB-style file with coordinates for d6drvd2.
(The format of our PDB-style files is described here.)

Timeline for d6drvd2:

  • d6drvd2 appears in periodic updates to SCOPe 2.07 starting on 2018-07-12