Lineage for d6drvd1 (6drv D:1-220)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2369590Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2369591Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2370433Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2370434Protein automated matches [190770] (43 species)
    not a true protein
  7. 2370602Species Escherichia coli [TaxId:83333] [272122] (10 PDB entries)
  8. 3054729Domain d6drvd1: 6drv D:1-220 [354791]
    Other proteins in same PDB: d6drvd2, d6drvd3, d6drvd4, d6drvd5
    automated match to d1f4ha3

Details for d6drvd1

PDB Entry: 6drv (more details), 2.2 Å

PDB Description: beta-galactosidase
PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d6drvd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6drvd1 b.18.1.0 (D:1-220) automated matches {Escherichia coli [TaxId: 83333]}
mtmitdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewr
fawfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenp
tgcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflra
genrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d6drvd1:

Click to download the PDB-style file with coordinates for d6drvd1.
(The format of our PDB-style files is described here.)

Timeline for d6drvd1:

  • d6drvd1 appears in periodic updates to SCOPe 2.07 starting on 2018-07-12