Class a: All alpha proteins [46456] (290 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
Protein automated matches [226851] (46 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [354674] (11 PDB entries) |
Domain d5y8nb2: 5y8n B:160-290 [354782] Other proteins in same PDB: d5y8na1, d5y8nb1, d5y8nb3 automated match to d1yb4a2 complexed with 9on, akr, gol, nad, ser |
PDB Entry: 5y8n (more details), 2.68 Å
SCOPe Domain Sequences for d5y8nb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5y8nb2 a.100.1.0 (B:160-290) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} aagagqaakvcnnmvlavqqiaiaeafvlaeklglsaqslfdvitgatgncwavhtncpv pgpvptspanndfkpgfstalmnkdlglamdavaatgataplgshaadiyakfaadhadl dfsavihtlra
Timeline for d5y8nb2: