SCOPe 2.08: Domain d5utzc2: 5utz C:112-213

Lineage for d5utzc2 (5utz C:112-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5utzc2: 5utz C:112-213 [354765]
   Other proteins in same PDB: d5utza_, d5utzb_, d5utzc1, d5utzd_, d5utze_, d5utzf_, d5utzg1, d5utzh_, d5utzi_, d5utzj_, d5utzk1, d5utzl1
   automated match to d1lila2
   complexed with gol

Details for d5utzc2

PDB Entry: 5utz, 2.75 Å

PDB Description: human il-2/fab complex

PDB Compounds: (C:) Fab 5111 light chain

SCOPe Domain Sequences for d5utzc2:

Sequence; same for both SEQRES and ATOM records:

>d5utzc2 b.1.1.2 (C:112-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

Timeline for d5utzc2:

• d5utzc2 first appeared in SCOPe 2.07