SCOPe 2.07: Domain d5ya2c_: 5ya2 C:

Lineage for d5ya2c_ (5ya2 C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.94: HPr-like [55593] (2 superfamilies)
   beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423

4. Superfamily d.94.1: HPr-like [55594] (2 families)

5. Family d.94.1.1: HPr-like [55595] (3 proteins)
   automatically mapped to Pfam PF00381

6. Protein Histidine-containing phosphocarrier protein (HPr) [55596] (8 species)

7. Species Escherichia coli [TaxId:562] [55599] (23 PDB entries)

8. Domain d5ya2c_: 5ya2 C: [354700]
   automated match to d2jelp_
   complexed with adp, hez, po4

Details for d5ya2c_

PDB Entry: 5ya2, 2.7 Å

PDB Description: crystal structure of lsrk-hpr complex with adp

PDB Compounds: (C:) Phosphocarrier protein HPr

SCOPe Domain Sequences for d5ya2c_:

Sequence; same for both SEQRES and ATOM records:

>d5ya2c_ d.94.1.1 (C:) Histidine-containing phosphocarrier protein (HPr) {Escherichia coli [TaxId: 562]}
mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
vtisaegedeqkavehlvklmaele

Timeline for d5ya2c_:

• d5ya2c_ is new in SCOPe 2.07-stable
  
• d5ya2c_ appears in the current release, SCOPe 2.08