Lineage for d6gfyl_ (6gfy L:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2364769Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2364948Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 2364949Family b.3.3.1: VHL [49469] (2 proteins)
  6. 2364950Protein VHL [49470] (1 species)
  7. 2364951Species Human (Homo sapiens) [TaxId:9606] [49471] (38 PDB entries)
  8. 3054606Domain d6gfyl_: 6gfy L: [354668]
    Other proteins in same PDB: d6gfya_, d6gfyb1, d6gfyb2, d6gfyd_, d6gfye1, d6gfye2, d6gfyg_, d6gfyh1, d6gfyh2, d6gfyj_, d6gfyk1, d6gfyk2
    automated match to d1lqbc_
    complexed with exh

Details for d6gfyl_

PDB Entry: 6gfy (more details), 2.7 Å

PDB Description: pvhl:elob:eloc in complex with modified vh032 containing (3r,4s)-3- fluoro-4-hydroxyproline (ligand 14a)
PDB Compounds: (L:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d6gfyl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gfyl_ b.3.3.1 (L:) VHL {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerltqe

SCOPe Domain Coordinates for d6gfyl_:

Click to download the PDB-style file with coordinates for d6gfyl_.
(The format of our PDB-style files is described here.)

Timeline for d6gfyl_:

  • d6gfyl_ appears in periodic updates to SCOPe 2.07 starting on 2018-07-12