SCOPe 2.08: Domain d6g2nb_: 6g2n B:

Lineage for d6g2nb_ (6g2n B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.8: 5'(3')-deoxyribonucleotidase (dNT-2) [82382] (2 proteins)
   the insertion subdomain is a 4-helical bundle; dephosphorylates dUMP and dTMP
   automatically mapped to Pfam PF06941

6. Protein automated matches [190171] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186899] (19 PDB entries)

8. Domain d6g2nb_: 6g2n B: [354602]
   automated match to d2jara_
   complexed with mg, o84

Details for d6g2nb_

PDB Entry: 6g2n, 1.4 Å

PDB Description: crystal structure of human cytosolic 5'(3')-deoxyribonucleotidase in complex with the inhibitor pb-pau

PDB Compounds: (B:) 5'(3')-deoxyribonucleotidase, cytosolic type

SCOPe Domain Sequences for d6g2nb_:

Sequence; same for both SEQRES and ATOM records:

>d6g2nb_ c.108.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svrvlvdmdgvladfeagllrgfrrrfpeephvpleqrrgflareqyralrpdladkvas
vyeapgffldlepipgaldavremndlpdtqvfictspllkyhhcvgekyrwveqhlgpq
fveriiltrdktvvlgdlliddkdtvrgqeetpswehilftcchnrhlvlpptrrrllsw
sdnwreildskr

Timeline for d6g2nb_:

• d6g2nb_ first appeared in SCOPe 2.07