SCOPe 2.08: Domain d6gfyf_: 6gfy F:

Lineage for d6gfyf_ (6gfy F:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.3: VHL [49468] (1 family)
   automatically mapped to Pfam PF01847

5. Family b.3.3.1: VHL [49469] (2 proteins)

6. Protein VHL [49470] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49471] (41 PDB entries)

8. Domain d6gfyf_: 6gfy F: [354594]
   Other proteins in same PDB: d6gfya_, d6gfyb1, d6gfyb2, d6gfyd_, d6gfye1, d6gfye2, d6gfyg_, d6gfyh1, d6gfyh2, d6gfyj_, d6gfyk1, d6gfyk2
   automated match to d1lqbc_
   complexed with exh

Details for d6gfyf_

PDB Entry: 6gfy, 2.7 Å

PDB Description: pvhl:elob:eloc in complex with modified vh032 containing (3r,4s)-3- fluoro-4-hydroxyproline (ligand 14a)

PDB Compounds: (F:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d6gfyf_:

Sequence; same for both SEQRES and ATOM records:

>d6gfyf_ b.3.3.1 (F:) VHL {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerltqe

Timeline for d6gfyf_:

• d6gfyf_ first appeared in SCOPe 2.07