Lineage for d6gfya_ (6gfy A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2501112Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2501137Protein Elongin B [54246] (2 species)
  7. 2501138Species Human (Homo sapiens) [TaxId:9606] [54247] (49 PDB entries)
  8. 3054525Domain d6gfya_: 6gfy A: [354587]
    Other proteins in same PDB: d6gfyb1, d6gfyb2, d6gfyc_, d6gfye1, d6gfye2, d6gfyf_, d6gfyh1, d6gfyh2, d6gfyi_, d6gfyk1, d6gfyk2, d6gfyl_
    automated match to d1lqba_
    complexed with exh

Details for d6gfya_

PDB Entry: 6gfy (more details), 2.7 Å

PDB Description: pvhl:elob:eloc in complex with modified vh032 containing (3r,4s)-3- fluoro-4-hydroxyproline (ligand 14a)
PDB Compounds: (A:) Elongin-B

SCOPe Domain Sequences for d6gfya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gfya_ d.15.1.1 (A:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvmk

SCOPe Domain Coordinates for d6gfya_:

Click to download the PDB-style file with coordinates for d6gfya_.
(The format of our PDB-style files is described here.)

Timeline for d6gfya_:

  • d6gfya_ appears in periodic updates to SCOPe 2.07 starting on 2018-07-12