Lineage for d6c5wc_ (6c5w C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742211Species Escherichia coli [TaxId:83333] [354477] (1 PDB entry)
  8. 2742212Domain d6c5wc_: 6c5w C: [354517]
    automated match to d5j1sc_
    complexed with ca

Details for d6c5wc_

PDB Entry: 6c5w (more details), 3.1 Å

PDB Description: crystal structure of the mitochondrial calcium uniporter
PDB Compounds: (C:) Nanobody

SCOPe Domain Sequences for d6c5wc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c5wc_ b.1.1.1 (C:) automated matches {Escherichia coli [TaxId: 83333]}
vqlqesggglvqaggslrlscaasgtifsphymgwyrqapgkerefvagigfgtttnyan
svkgrftisrdnakntvylqmnslkpedtavyycaarlypilghtywgqgtqvtvss

SCOPe Domain Coordinates for d6c5wc_:

Click to download the PDB-style file with coordinates for d6c5wc_.
(The format of our PDB-style files is described here.)

Timeline for d6c5wc_: