Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Escherichia coli [TaxId:83333] [354477] (1 PDB entry) |
Domain d6c5wc_: 6c5w C: [354517] automated match to d5j1sc_ complexed with ca |
PDB Entry: 6c5w (more details), 3.1 Å
SCOPe Domain Sequences for d6c5wc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6c5wc_ b.1.1.1 (C:) automated matches {Escherichia coli [TaxId: 83333]} vqlqesggglvqaggslrlscaasgtifsphymgwyrqapgkerefvagigfgtttnyan svkgrftisrdnakntvylqmnslkpedtavyycaarlypilghtywgqgtqvtvss
Timeline for d6c5wc_: