Lineage for d6dxnd1 (6dxn D:34-222)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879932Species Klebsiella pneumoniae [TaxId:573] [354497] (1 PDB entry)
  8. 2879936Domain d6dxnd1: 6dxn D:34-222 [354504]
    Other proteins in same PDB: d6dxna2, d6dxnb2, d6dxnc2, d6dxnd2
    automated match to d4ocea_
    complexed with pge

Details for d6dxnd1

PDB Entry: 6dxn (more details), 1.95 Å

PDB Description: 1.95 angstrom resolution crystal structure of dsba disulfide interchange protein from klebsiella pneumoniae.
PDB Compounds: (D:) thiol:disulfide interchange protein

SCOPe Domain Sequences for d6dxnd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dxnd1 c.47.1.0 (D:34-222) automated matches {Klebsiella pneumoniae [TaxId: 573]}
kdyqagknftvihstvkqppplveffsfycgpcyafaerinvdtairkrlpddmklekyh
vsqmgplgpalteawavaqyagvdgkvekllfeglqvkrdiktaadivkvfnqlgitsek
yaemqsnfmvkaliarqdnlvekmkvhgtpsfyvsgkyhinnaslaqddydtyaedmanl
vlfllnkpl

SCOPe Domain Coordinates for d6dxnd1:

Click to download the PDB-style file with coordinates for d6dxnd1.
(The format of our PDB-style files is described here.)

Timeline for d6dxnd1: