Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (195 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:573] [354497] (1 PDB entry) |
Domain d6dxnd1: 6dxn D:34-222 [354504] Other proteins in same PDB: d6dxna2, d6dxnb2, d6dxnc2, d6dxnd2 automated match to d4ocea_ complexed with pge |
PDB Entry: 6dxn (more details), 1.95 Å
SCOPe Domain Sequences for d6dxnd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6dxnd1 c.47.1.0 (D:34-222) automated matches {Klebsiella pneumoniae [TaxId: 573]} kdyqagknftvihstvkqppplveffsfycgpcyafaerinvdtairkrlpddmklekyh vsqmgplgpalteawavaqyagvdgkvekllfeglqvkrdiktaadivkvfnqlgitsek yaemqsnfmvkaliarqdnlvekmkvhgtpsfyvsgkyhinnaslaqddydtyaedmanl vlfllnkpl
Timeline for d6dxnd1: