Lineage for d1fuic2 (1fui C:1-355)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27750Fold c.85: L-fucose isomerase, N-terminal and second domains [53742] (1 superfamily)
  4. 27751Superfamily c.85.1: L-fucose isomerase, N-terminal and second domains [53743] (1 family) (S)
  5. 27752Family c.85.1.1: L-fucose isomerase, N-terminal and second domains [53744] (1 protein)
  6. 27753Protein L-fucose isomerase, N-terminal and second domains [53745] (1 species)
  7. 27754Species Escherichia coli [TaxId:562] [53746] (1 PDB entry)
  8. 27757Domain d1fuic2: 1fui C:1-355 [35446]
    Other proteins in same PDB: d1fuia1, d1fuib1, d1fuic1, d1fuid1, d1fuie1, d1fuif1

Details for d1fuic2

PDB Entry: 1fui (more details), 2.5 Å

PDB Description: l-fucose isomerase from escherichia coli

SCOP Domain Sequences for d1fuic2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fuic2 c.85.1.1 (C:1-355) L-fucose isomerase, N-terminal and second domains {Escherichia coli}
mkkislpkigirpvidgrrmgvresleeqtmnmakataallteklrhacgaavecvisdt
ciagmaeaaaceekfssqnvgltitvtpcwcygsetidmdptrpkaiwgfngterpgavy
laaalaahsqkgipafsiyghdvqdaddtsipadveekllrfaraglavasmkgksylsl
ggvsmgiagsivdhnffeswlgmkvqavdmtelrrridqkiydeaelemalawadknfry
gedennkqyqrnaeqsravlresllmamcirdmmqgnskladigrveeslgynaiaagfq
gqrhwtdqypngdtaeailnssfdwngvrepfvvatendslngvamlmghqltgt

SCOP Domain Coordinates for d1fuic2:

Click to download the PDB-style file with coordinates for d1fuic2.
(The format of our PDB-style files is described here.)

Timeline for d1fuic2: