SCOPe 2.08: Domain d5yptf1: 5ypt F:10-237

Lineage for d5yptf1 (5ypt F:10-237)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Marchantia polymorpha [TaxId:3197] [354367] (1 PDB entry)

8. Domain d5yptf1: 5ypt F:10-237 [354437]
   automated match to d3wd8a1

Details for d5yptf1

PDB Entry: 5ypt, 2.39 Å

PDB Description: crystal structure of marchantia paleacea chalone synthase like 1 (chsl1)

PDB Compounds: (F:) Stilbenecarboxylate synthase 1

SCOPe Domain Sequences for d5yptf1:

Sequence; same for both SEQRES and ATOM records:

>d5yptf1 c.95.1.0 (F:10-237) automated matches {Marchantia polymorpha [TaxId: 3197]}
ykhrraagpatvlaigkatpptaysqseypdfffditntshktelkakfaricknsgint
ryfhctedilkanpsmctylepsldvrqdiairevprlaekaaiealaewgqprdqithv
vfattsgvnmpgadltltrllglnpnvkrtmlyqqgcfggatvlrvakdlaennkgarvl
tvvseltcvtfrapneehldnlvgsaifgdgasvlvigsdpipevekp

Timeline for d5yptf1:

• d5yptf1 first appeared in SCOPe 2.07