Lineage for d5yzhb_ (5yzh B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905791Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2905792Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2905793Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 2905990Protein automated matches [190072] (22 species)
    not a true protein
  7. 2906083Species Mouse (Mus musculus) [TaxId:10090] [187557] (3 PDB entries)
  8. 2906085Domain d5yzhb_: 5yzh B: [354414]
    automated match to d1t0la_
    complexed with gol, nap

Details for d5yzhb_

PDB Entry: 5yzh (more details), 1.99 Å

PDB Description: crystal structure of mouse cytosolic isocitrate dehydrogenase
PDB Compounds: (B:) isocitrate dehydrogenase [nadp] cytoplasmic

SCOPe Domain Sequences for d5yzhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yzhb_ c.77.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kiqggsvvemqgdemtriiwelikeklilpyveldlhsydlgienrdatndqvtkdaaea
ikkynvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprlvtg
wvkpiiigrhaygdqyratdfvvpgpgkveitytpkdgtqkvtymvhdfeegggvamgmy
nqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkkyksqfeaqk
icyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlicpdgktv
eaeaahgtvtrhyrmyqkgqetstnpiasifawsrglahrakldnntelsffakaledvc
ietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkaklaqa

SCOPe Domain Coordinates for d5yzhb_:

Click to download the PDB-style file with coordinates for d5yzhb_.
(The format of our PDB-style files is described here.)

Timeline for d5yzhb_: