Lineage for d5odbb1 (5odb B:3-108)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (21 species)
    not a true protein
  7. 2347244Species Human (Homo sapiens) [TaxId:9606] [188740] (228 PDB entries)
  8. 3054325Domain d5odbb1: 5odb B:3-108 [354387]
    Other proteins in same PDB: d5odbb2
    automated match to d1lila1
    complexed with gol, so4

Details for d5odbb1

PDB Entry: 5odb (more details), 1.53 Å

PDB Description: crystal structure of the ra-associated mab d10 (chimeric fab fragment)
PDB Compounds: (B:) D10 Fab fragment - light chain

SCOPe Domain Sequences for d5odbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5odbb1 b.1.1.1 (B:3-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yeltqppsvsvspgqtasitcsgdklgdkyacwyqqkpgqspvlviyqhskrpsgiperf
sgsnsgntatltisgtqamdeadyycqawdsstvvfgggtkltvlg

SCOPe Domain Coordinates for d5odbb1:

Click to download the PDB-style file with coordinates for d5odbb1.
(The format of our PDB-style files is described here.)

Timeline for d5odbb1: