Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein automated matches [227071] (7 species) not a true protein |
Species Pig (Sus scrofa) [TaxId:9823] [278816] (66 PDB entries) |
Domain d5xkea2: 5xke A:246-437 [354380] Other proteins in same PDB: d5xkea1, d5xkeb1, d5xkec1, d5xked1, d5xkee_, d5xkef1, d5xkef2, d5xkef3 automated match to d4i50a2 complexed with ca, gdp, gol, gtp, lon, mes, mg |
PDB Entry: 5xke (more details), 2.6 Å
SCOPe Domain Sequences for d5xkea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xkea2 d.79.2.1 (A:246-437) automated matches {Pig (Sus scrofa) [TaxId: 9823]} galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm aalekdyeevgv
Timeline for d5xkea2: