Lineage for d6aqrb_ (6aqr B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2344561Fold a.301: Sus1-like [310571] (1 superfamily)
    5 helices; articulated hairpin fold
  4. 2344562Superfamily a.301.1: Sus1-like [310603] (1 family) (S)
    Pfam PF10163
    interactions with Sac3, Cdc31 described in PubMed 19328066
  5. 2344563Family a.301.1.1: Sus1-like [310653] (3 proteins)
  6. 2344570Protein Sus1 [310814] (1 species)
  7. 2344571Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [311080] (14 PDB entries)
  8. 3054267Domain d6aqrb_: 6aqr B: [354329]
    Other proteins in same PDB: d6aqrd_
    automated match to d3fwbc_
    complexed with zn

Details for d6aqrb_

PDB Entry: 6aqr (more details), 2.1 Å

PDB Description: saga dub module ubp8(c146a)/sgf11/sus1/sgf73 bound to monoubiquitin
PDB Compounds: (B:) Transcription and mRNA export factor SUS1

SCOPe Domain Sequences for d6aqrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aqrb_ a.301.1.1 (B:) Sus1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
taqlksqiqqylvesgnyelisnelkarllqegwvdkvkdltksemninestnftqilst
vepkalemvsdstretvlkqirefleeivdt

SCOPe Domain Coordinates for d6aqrb_:

Click to download the PDB-style file with coordinates for d6aqrb_.
(The format of our PDB-style files is described here.)

Timeline for d6aqrb_:

  • d6aqrb_ is new in SCOPe 2.07-stable