Class a: All alpha proteins [46456] (290 folds) |
Fold a.301: Sus1-like [310571] (1 superfamily) 5 helices; articulated hairpin fold |
Superfamily a.301.1: Sus1-like [310603] (1 family) Pfam PF10163 interactions with Sac3, Cdc31 described in PubMed 19328066 |
Family a.301.1.1: Sus1-like [310653] (3 proteins) |
Protein Sus1 [310814] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [311080] (14 PDB entries) |
Domain d6aqrb_: 6aqr B: [354329] Other proteins in same PDB: d6aqrd_ automated match to d3fwbc_ complexed with zn |
PDB Entry: 6aqr (more details), 2.1 Å
SCOPe Domain Sequences for d6aqrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6aqrb_ a.301.1.1 (B:) Sus1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} taqlksqiqqylvesgnyelisnelkarllqegwvdkvkdltksemninestnftqilst vepkalemvsdstretvlkqirefleeivdt
Timeline for d6aqrb_: