SCOPe 2.08: Domain d5od0l2: 5od0 L:112-214

Lineage for d5od0l2 (5od0 L:112-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5od0l2: 5od0 L:112-214 [354324]
   Other proteins in same PDB: d5od0h_
   automated match to d1aqkl2
   complexed with gol

Details for d5od0l2

PDB Entry: 5od0, 1.8 Å

PDB Description: crystal structure of acpa e4

PDB Compounds: (L:) Fab fragment of ACPA E4 - Light chain

SCOPe Domain Sequences for d5od0l2:

Sequence; same for both SEQRES and ATOM records:

>d5od0l2 b.1.1.0 (L:112-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq
snnkymassyltltarawerhssyscqvtheghtvekslsrad

Timeline for d5od0l2:

• d5od0l2 first appeared in SCOPe 2.07