Lineage for d5xjra_ (5xjr A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2380450Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2380451Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2380452Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins)
    forms homo and heteroheptameric ring structures
    Pfam PF01423
  6. 2380633Protein D1 core SNRNP protein [50184] (4 species)
  7. 2380634Species Human (Homo sapiens) [TaxId:9606] [50185] (11 PDB entries)
  8. 3054242Domain d5xjra_: 5xjr A: [354304]
    Other proteins in same PDB: d5xjrb_, d5xjre_, d5xjrf_, d5xjrg_
    automated match to d4f7ua_

Details for d5xjra_

PDB Entry: 5xjr (more details), 3.12 Å

PDB Description: crystal structure of the gemin2-binding domain of smn, gemin2dn39 in complex with smd1(1-82)/d2/f/e/g from human
PDB Compounds: (A:) Small nuclear ribonucleoprotein Sm D1

SCOPe Domain Sequences for d5xjra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xjra_ b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]}
mklvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsi
rgnniryfilpdslpldtllv

SCOPe Domain Coordinates for d5xjra_:

Click to download the PDB-style file with coordinates for d5xjra_.
(The format of our PDB-style files is described here.)

Timeline for d5xjra_: