Class b: All beta proteins [48724] (180 folds) |
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) |
Family b.74.1.0: automated matches [191576] (1 protein) not a true family |
Protein automated matches [191011] (16 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188766] (28 PDB entries) |
Domain d6g9ua_: 6g9u A: [354267] automated match to d1hcba_ complexed with etk, zn |
PDB Entry: 6g9u (more details), 1.75 Å
SCOPe Domain Sequences for d6g9ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6g9ua_ b.74.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rvspacagrfqspvdirpqlaafspalrplellgfqlpplpelrlrnnghsvqltlppgl emalgpgreyralqlhlhwgaagrpgsehtveghrfpaeihvvhlstafarvdealgrpg glavlaafleegpeensayeqllsrleeiaeegsetqvpgldisallpsdfsryfqyegs lttppcaqgviwtvfnqtvmlsakqlhtlsdtlwgpgdsrlqlnfratqplngrvieasf p
Timeline for d6g9ua_: