Lineage for d6daud_ (6dau D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969531Species Vibrio cholerae [TaxId:666] [188612] (22 PDB entries)
  8. 2969584Domain d6daud_: 6dau D: [354252]
    automated match to d4mhdc_
    complexed with gol; mutant

Details for d6daud_

PDB Entry: 6dau (more details), 2.26 Å

PDB Description: crystal structure of e33q and e41q mutant forms of the spermidine/spermine n-acetyltransferase speg from vibrio cholerae
PDB Compounds: (D:) Spermidine n1-acetyltransferase

SCOPe Domain Sequences for d6daud_:

Sequence, based on SEQRES records: (download)

>d6daud_ d.108.1.0 (D:) automated matches {Vibrio cholerae [TaxId: 666]}
nsqltlralergdlrfihnlnnnrnimsywfqepyesfdqleelynkhihdnaerrfvve
daqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiyl
hvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnrse

Sequence, based on observed residues (ATOM records): (download)

>d6daud_ d.108.1.0 (D:) automated matches {Vibrio cholerae [TaxId: 666]}
nsqltlralergdlrfihnlnnnrnimsywfqepyesfdqleelynkhihdnaerrfvve
daqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiyl
hvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnre

SCOPe Domain Coordinates for d6daud_:

Click to download the PDB-style file with coordinates for d6daud_.
(The format of our PDB-style files is described here.)

Timeline for d6daud_: