SCOPe 2.08: Domain d6dpub1: 6dpu B:1-245

Lineage for d6dpub1 (6dpu B:1-245)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (9 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [278808] (66 PDB entries)

8. Domain d6dpub1: 6dpu B:1-245 [354239]
   Other proteins in same PDB: d6dpua2, d6dpub2, d6dpuc2, d6dpud2, d6dpue2, d6dpuf2, d6dpug2, d6dpuh2, d6dpui2, d6dpuj2, d6dpuk2, d6dpul2
   automated match to d4drxb1
   complexed with g2p, gtp, mg

Details for d6dpub1

PDB Entry: 6dpu, 3.1 Å

PDB Description: undecorated gmpcpp microtubule

PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d6dpub1:

Sequence; same for both SEQRES and ATOM records:

>d6dpub1 c.32.1.1 (B:1-245) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

Timeline for d6dpub1:

• d6dpub1 first appeared in SCOPe 2.07