Lineage for d6a0xf2 (6a0x F:108-214)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752865Domain d6a0xf2: 6a0x F:108-214 [354208]
    Other proteins in same PDB: d6a0xa_, d6a0xb1, d6a0xc_, d6a0xd1, d6a0xe_, d6a0xf1, d6a0xg_, d6a0xh1
    automated match to d1tqbc2

Details for d6a0xf2

PDB Entry: 6a0x (more details), 2.3 Å

PDB Description: crystal structure of broadly neutralizing antibody 13d4
PDB Compounds: (F:) Antibody 13D4, Fab Light Chain

SCOPe Domain Sequences for d6a0xf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a0xf2 b.1.1.2 (F:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltrdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d6a0xf2:

Click to download the PDB-style file with coordinates for d6a0xf2.
(The format of our PDB-style files is described here.)

Timeline for d6a0xf2: