Lineage for d5oyao_ (5oya O:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957669Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2957670Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2957953Family d.73.1.0: automated matches [336551] (1 protein)
    not a true family
  6. 2957954Protein automated matches [336552] (9 species)
    not a true protein
  7. 2957955Species Chaetoceros socialis [TaxId:163503] [353971] (1 PDB entry)
  8. 2957962Domain d5oyao_: 5oya O: [354180]
    Other proteins in same PDB: d5oyaa1, d5oyaa2, d5oyab1, d5oyab2, d5oyac1, d5oyac2, d5oyad1, d5oyad2, d5oyae1, d5oyae2, d5oyaf1, d5oyaf2, d5oyag1, d5oyag2, d5oyah1, d5oyah2
    automated match to d1iwab_
    complexed with cap, edo, mg

Details for d5oyao_

PDB Entry: 5oya (more details), 1.8 Å

PDB Description: unusual posttranslational modifications revealed in crystal structures of diatom rubisco.
PDB Compounds: (O:) Rubisco small subunit

SCOPe Domain Sequences for d5oyao_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oyao_ d.73.1.0 (O:) automated matches {Chaetoceros socialis [TaxId: 163503]}
mrltqgcfsflpdltdaqiekqvayamsrgwamnvewtddphprnnywelwglplfdikd
patvmfelnearkscaagyirmnafdasygtescvmsfltnrpanepgfyldrtdgigrq
iiysiksysvqanpegsry

SCOPe Domain Coordinates for d5oyao_:

Click to download the PDB-style file with coordinates for d5oyao_.
(The format of our PDB-style files is described here.)

Timeline for d5oyao_: