Lineage for d5zbka_ (5zbk A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922906Fold c.129: MCP/YpsA-like [102404] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567
  4. 2922907Superfamily c.129.1: MCP/YpsA-like [102405] (6 families) (S)
  5. 2922991Family c.129.1.0: automated matches [233357] (1 protein)
    not a true family
  6. 2922992Protein automated matches [233358] (8 species)
    not a true protein
  7. 2923025Species Pseudomonas aeruginosa [TaxId:208964] [354089] (2 PDB entries)
  8. 2923027Domain d5zbka_: 5zbk A: [354108]
    automated match to d5itsc_
    complexed with amp, edo, gol

Details for d5zbka_

PDB Entry: 5zbk (more details), 2.3 Å

PDB Description: crystal structure of type-i log from pseudomonas aeruginosa pao1 in complex with amp
PDB Compounds: (A:) Putative cytokinin riboside 5'-monophosphate phosphoribohydrolase

SCOPe Domain Sequences for d5zbka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zbka_ c.129.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
tlrsvcvfcgaspgaspvyqeaavalgrhlaergltlvygggavglmgtvadaalaagge
vigiipqslqeaeighkgltrlevvdgmharkarmaeladafialpgglgtlealfevwt
wgqlgyhakplgllevngfydplltfldhlvderfvraehrgmlqrgaspealldalaaw
tp

SCOPe Domain Coordinates for d5zbka_:

Click to download the PDB-style file with coordinates for d5zbka_.
(The format of our PDB-style files is described here.)

Timeline for d5zbka_: