Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.129: MCP/YpsA-like [102404] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567 |
Superfamily c.129.1: MCP/YpsA-like [102405] (6 families) |
Family c.129.1.0: automated matches [233357] (1 protein) not a true family |
Protein automated matches [233358] (8 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:208964] [354089] (2 PDB entries) |
Domain d5zbka_: 5zbk A: [354108] automated match to d5itsc_ complexed with amp, edo, gol |
PDB Entry: 5zbk (more details), 2.3 Å
SCOPe Domain Sequences for d5zbka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zbka_ c.129.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]} tlrsvcvfcgaspgaspvyqeaavalgrhlaergltlvygggavglmgtvadaalaagge vigiipqslqeaeighkgltrlevvdgmharkarmaeladafialpgglgtlealfevwt wgqlgyhakplgllevngfydplltfldhlvderfvraehrgmlqrgaspealldalaaw tp
Timeline for d5zbka_: